Home > Reesephoto.me
- review & score your website page rank!

Reesephoto.me

smart website page rank analysis & review
Data analyzed
Refresh analysis Visit website Grab badge
1Page Rank Score
155
/ 1000

Reesephoto.me website review:

Reesephoto.me website is scored 155 1Pagerank.com points (1PRS) and has a global traffic ranking of 4,862,037 in the world. This website Google PageRank is 2 out of maximum 10 and its estimated worth is about $ 240.00. It has potential to earn online around $ 1.00 US Dollar daily. Reesephoto.me was registered 7 years 7 months ago (2012-01-14) and is hosted in California, San Francisco, United States.

Estimated worth

$240
Approx. Reesephoto.me worth in US Dollars

Down Or Up?

Site Reesephoto.me is Up!

Rank Analysis

2 of 10
Google PageRank
4,862,037
Alexa Global Rank

Traffic prediction

93
Approx. Daily Unique visitors
186
Approx. Daily Pageviews

SE Page Indexes

-
Indexed Pages by Google
-
Indexed Pages by Yahoo
1
Indexed Pages by Bing

Backlinks count

-
Indexed Backlinks by Google
31
Indexed Backlinks by Alexa
-
Indexed Backlinks by Bing

Facebook Stats

73
Facebook shares
-
Facebook likes
-
Facebook comments

Social Buzz

-
Google+
-
Tweets
-
Pinterest

Social Buzz

-
LinkedIn shares
-
Delicious
-
StumbleUpon

Extra details

WR link
Website QR data
Safe
Safe for kids
Quantcast Rank
US Rank

Safety & Security

reesephoto.me security

Not Yet Tested
SiteAdvisor Verdict
Trustworthiness:
Vendor reliability:
Privacy:
Child Safety:
reesephoto.me Norton safe web

Safe
Norton SafeWeb

DNS information

Type Target TTL
A 76.74.254.120 300
A 192.0.80.250 300
A 76.74.254.123 300
A 66.155.9.238 300
A 66.155.11.238 300
A 192.0.81.250 300
NS ns1.wordpress.com 21600
NS ns2.wordpress.com 21600
NS ns3.wordpress.com 21600
SOA ns1.wordpress.com hostmaster.wordpress.com 21600
Server and DNS Health
Check DNS Status

Meta Title

Donald Reese Photography | All images copyrighted. Please don't use without permission

Meta Description

All images copyrighted. Please don't use without permission

Meta Keywords

No meta tags provided

Website badges

Server Locator

Reesephoto.me
Location: US reesephoto.me Hosted Country
Server IP:
76.74.254.123
Latitude: 37.7484
Longitude: -122.414
All Domains on this server

Nameserver SPY

Nameserver Host Nameserver IP Address Country
ns1.wordpress.com 192.0.80.93
ns2.wordpress.com 69.174.248.148 United States

Domain Radar

Domain Registrar: doMEn List all Registrar domains
Domain TLD: .me List All .me Domains
Registered: 2012-01-14 7 years 7 months 11 hours ago
Last Modified: 2013-11-14 5 years 8 months 4 weeks ago
Expires: 2015-01-14 4 years 6 months 4 weeks ago

Activity

Alexa Global Rank Dynamics
Alexa Traffic Rank for reesephoto.me
Backlink Discovery Dynamics
1Pagerank Graph

Similar Ranked Domains

Domain Alexa Pagerank Worth
hostcerto.com.br Favicon hostcerto.com.br 4,862,169 hostcerto.com.br Google Pagerank $ 240.00
wealthmakerfinancialservices.com.au Favicon wealthmakerfinancialservices.com.au 4,862,179 wealthmakerfinancialservices.com.au Google Pagerank $ 240.00
aplay.vn Favicon aplay.vn 4,862,194 aplay.vn Google Pagerank $ 240.00
maktub.org.ua Favicon maktub.org.ua 4,862,202 maktub.org.ua Google Pagerank $ 240.00
moraless.com Favicon moraless.com 4,862,206 moraless.com Google Pagerank $ 240.00

Reesephoto.me user reviews

0 / 0

Total user rating

Please review Reesephoto.me website!